PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART03G02190.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 210aa    MW: 23228.2 Da    PI: 9.1018
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART03G02190.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.24.9e-1061119563
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      kr +r   NR +A rs +RK  +i+eLe+kv+ L++e + L  +l +++  +a l +++
  OBART03G02190.1  61 KRVKRVLANRQSAARSKERKMRYIAELEQKVQILQSEATNLSAQLTMMQRDSAGLATQN 119
                      999***************************************99999988887776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-1557121IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.59959122IPR004827Basic-leucine zipper domain
PfamPF001706.4E-961119IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.3E-1061118No hitNo description
SuperFamilySSF579592.67E-1161112No hitNo description
CDDcd147031.43E-1862113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MDSLIGKFNF TAGTAAAAGN GVALGPNRFS LEFGSGEFTP SEMKKIMADE KLAEMALADP  60
KRVKRVLANR QSAARSKERK MRYIAELEQK VQILQSEATN LSAQLTMMQR DSAGLATQNN  120
ELKFRLHAME QQAQLRDALN EALTTEVQRL KLATAELGDS CSSSSLAQQI QLNAQNQMFQ  180
LQQQQATQIP FYQLQQSQQN GAAKNNESKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015627932.11e-147PREDICTED: transcription factor RF2b-like
SwissprotQ6S4P49e-52RF2B_ORYSJ; Transcription factor RF2b
TrEMBLA0A0D3FDA61e-150A0A0D3FDA6_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0GG661e-147A0A0E0GG66_ORYNI; Uncharacterized protein
TrEMBLA2XC021e-147A2XC02_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA011761-PA1e-147(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.35e-65bZIP family protein